제품 > 항체 > 다중클론항체(pAb)

DSPP Rabbit pAb (A25260)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with DSPP using DSPP Rabbit pAb(A25260) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 40.5 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 10s.

ABclonal:Immunofluorescence - DSPP Rabbit pAb (A25260)

Immunofluorescence analysis of Dental pulp stem cell using DSPP Rabbit pAb (A25260) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	DSPP Rabbit pAb
Catalog No.	A25260
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the small integrin-binding ligand N-linked glycoprotein (SIBLING) family of proteins. The encoded preproprotein is secreted by odontoblasts and proteolytically processed to generate two principal proteins of the dentin extracellular matrix of the tooth, dentin sialoprotein and dentin phosphoprotein. These two protein products may play distinct but related roles in dentin mineralization. Mutations in this gene are associated with dentinogenesis imperfecta and dentin dysplasia. This gene is present in a gene cluster on chromosome 4. Allelic differences due to repeat polymorphisms have been found for this gene.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 16-230 of human DSPP(NP_055023.2).
Sequence	IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQEDGPQVAGSNNSTDNEDEIIENSCRNEGNTSEITPQINSKRNGTKEAEVT
Gene ID
Swiss Prot
Synonyms	DPP; DSP; DGI1; DMP3; DFNA39; DSPP
Calculated MW	131kDa
Observed MW	97kDa, 131kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293F cells transfected with DSPP(Human)
Cellular location	Secreted, extracellular matrix, extracellular space