Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | DUSP5 Rabbit pAb |
---|---|
Catalog No. | A10212 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 315-384 of human DUSP5 (NP_004410.3). |
---|---|
Sequence | SEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC |
Gene ID | |
Swiss Prot | |
Synonyms | DUSP; HVH3 |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji |
Cellular location | Nucleus |
Customer validation | WB(Homo sapiens, Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10212? Please let us know so that we can cite the reference in this datasheet.