DVL2 Rabbit pAb (A7551)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

ABclonal:Immunofluorescence - DVL2 Rabbit pAb (A7551)

Immunofluorescence analysis of NIH/3T3 cells using DVL2 antibody (A7551) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	DVL2 Rabbit pAb
Catalog No.	A7551
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human DVL2 (NP_004413.1).
Sequence	GAGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPG
Gene ID
Swiss Prot
Synonyms	DVL2
Calculated MW	79kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Peripheral membrane protein, cytosol
Customer validation	WB(Mus musculus)