제품 > 항체 > 단일클론항체(mAb)

Dvl2 Rabbit mAb (A23686)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Dvl2 Rabbit mAb (A23686) at 1:9000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunofluorescence - Dvl2 Rabbit mAb (A23686)

Immunofluorescence analysis of NIH/3T3 cells using Dvl2 Rabbit mAb (A23686) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Dvl2 Rabbit mAb
Catalog No.	A23686
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61089

Background

This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human Dvl2 (NP_004413.1).
Sequence	GAGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPG
Gene ID
Swiss Prot
Synonyms
Calculated MW	79kDa
Observed MW	90-95kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:10000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293F
Cellular location	Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Peripheral membrane protein, cytosol
Customer validation	WB(Mus musculus)