제품 > 항체 > 다중클론항체(pAb)

DYNC1I1 Rabbit pAb (A3833)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DYNC1I1 Rabbit pAb (A3833) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - DYNC1I1 Rabbit pAb (A3833)

Immunohistochemistry analysis of paraffin-embedded human stomach using DYNC1I1 Rabbit pAb (A3833) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat brain using DYNC1I1 Rabbit pAb (A3833) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	DYNC1I1 Rabbit pAb
Catalog No.	A3833
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables spectrin binding activity. Involved in vesicle transport along microtubule. Located in several cellular components, including kinetochore; recycling endosome; and spindle pole.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human DYNC1I1 (NP_001129028.1).
Sequence	MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRT
Gene ID
Swiss Prot
Synonyms	DNCI1; DNCIC1; DYNC1I1
Calculated MW	73kDa
Observed MW	73kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IHC-P 1:20 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat, SH-SY5Y, HeLa, Mouse testis, Mouse brain, Mouse skeletal muscle, Rat brain, Rat testis
Cellular location	Chromosome, Cytoplasm, centromere, cytoskeleton, kinetochore, spindle pole