제품 > 항체 > 다중클론항체(pAb)

DYRK2 Rabbit pAb (A24467)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates, using DYRK2 Rabbit pAb (A24467) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - DYRK2 Rabbit pAb (A24467)

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using DYRK2 Rabbit pAb (A24467) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using DYRK2 Rabbit pAb (A24467) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using DYRK2 Rabbit pAb (A24467) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using DYRK2 Rabbit pAb (A24467) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Overview

Product name	DYRK2 Rabbit pAb
Catalog No.	A24467
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-600 of human DYRK2.
Sequence	LKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
Gene ID
Swiss Prot
Synonyms	DYRK2; dual specificity tyrosine-phosphorylation-regulated kinase 2
Calculated MW	59kDa/66kDa
Observed MW	66kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Saos-2, Daudi, U266 (Low expression control)
Cellular location	Cytoplasm, Nucleus.