제품 > 항체 > 다중클론항체(pAb)

Defb26 Rabbit pAb (A15903)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunofluorescence analysis of U2OS cells using Defb26 antibody (A15903) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	Defb26 Rabbit pAb
Catalog No.	A15903
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in defense response to bacterium and innate immune response. Predicted to be located in extracellular region. Orthologous to human DEFB125 (defensin beta 125).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-128 of rat Defb26 (NP_001032595.1).
Sequence	WRRMPPKCWKDNLGRCRVRCRGDERYIYLCRNKANCCILLTLAEDQSAHPKPTSVHPENVTWKNTSISPTTRYIDDITLDKTSIGTPTNVAGIGKALNLTVITPTHP
Gene ID
Swiss Prot
Synonyms	DEFB126; C20orf8; DEFB-26; DEFB26; HBD26; bA530N10.1; hBD-26
Calculated MW	14kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Secreted