제품 > 항체 > 단일클론항체(mAb)

Dopamine Receptor D3 (DRD3) Rabbit mAb (A4587)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Dopamine Receptor D3 (DRD3) Rabbit mAb (A4587) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	Dopamine Receptor D3 (DRD3) Rabbit mAb
Catalog No.	A4587
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1041

Background

This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D3 (DRD3) (P35462).
Sequence	MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR
Gene ID
Swiss Prot
Synonyms	D3DR; ETM1; FET1
Calculated MW	44kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, C6, SH-SY5Y, U-251MG, Mouse brain
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	WB(Mus musculus)