제품 > 항체 > 단일클론항체(mAb)

Dysferlin Rabbit mAb (A19572)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from RD cells, using Dysferlin (Romeo) Rabbit mAb (A19572) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Dysferlin Rabbit mAb (A19572)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse skeletal muscle tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Dysferlin Rabbit mAb (A19572) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	Dysferlin Rabbit mAb
Catalog No.	A19572
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2178

Background

The protein encoded by this gene belongs to the ferlin family and is a skeletal muscle protein found associated with the sarcolemma. It is involved in muscle contraction and contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. In addition, the protein encoded by this gene binds caveolin-3, a skeletal muscle membrane protein which is important in the formation of caveolae. Specific mutations in this gene have been shown to cause autosomal recessive limb girdle muscular dystrophy type 2B (LGMD2B) as well as Miyoshi myopathy. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Dysferlin (Romeo) (O75923).
Sequence	FEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDV
Gene ID
Swiss Prot
Synonyms	MMD1; FER1L1; LGMD2B; LGMDR2; Dysferlin (Romeo)
Calculated MW	237kDa
Observed MW	280kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	RD
Cellular location	Cytoplasmic vesicle, Endosome, Extracellular exosome, Plasma membrane, T-tubule.
Customer validation	WB(Homo sapiens, Rattus norvegicus)