Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | E2F7 Rabbit pAb |
---|---|
Catalog No. | A15211 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 540-740 of human E2F7 (NP_976328.2). |
---|---|
Sequence | LLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPAGLNGFNVLLSGSQTPPTVGPSSGQLPS |
Gene ID | |
Swiss Prot | |
Synonyms | E2F7 |
Calculated MW | 100kDa |
Observed MW | 105kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, SP2/0, Mouse spleen, Rat spleen |
Cellular location | Nucleus |
Customer validation | WB(Homo sapiens) IHC(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15211? Please let us know so that we can cite the reference in this datasheet.