제품 > 항체 > 단일클론항체(mAb)

EAAT2 Rabbit mAb (A25213)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using EAAT2 Rabbit mAb (A25213) at 1:9000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse heart.
Exposure time: 30s.

ABclonal:Immunohistochemistry - EAAT2 Rabbit mAb (A25213)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1：8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1：8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using EAAT2 Rabbit mAb (A25213) at a dilution of 1：8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - EAAT2 Rabbit mAb (A25213)

Confocal imaging of paraffin-embedded Mouse brain tissue using EAAT2 Rabbit mAb (A25213, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	EAAT2 Rabbit mAb
Catalog No.	A25213
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63682

Background

This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 470-574 of human EAAT2(NP_004162.2).
Sequence	VDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Gene ID
Swiss Prot
Synonyms	GLT1; HBGT; DEE41; EAAT2; GLT-1; EIEE41; EAAT2/SLC1A2
Calculated MW	62kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:9000 - 1:36000 IHC-P 1:800 - 1:8000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse brain
Cellular location	Membrane, Multi-pass membrane protein.
Customer validation	WB(Mus musculus)