제품 > 항체 > 다중클론항체(pAb)

ECE2 Rabbit pAb (A7049)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using ECE2 antibody (A7049) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

Overview

Product name	ECE2 Rabbit pAb
Catalog No.	A7049
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables metalloendopeptidase activity. Involved in peptide hormone processing. Located in cytoplasmic vesicle membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ECE2 (NP_115707.2).
Sequence	MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSE
Gene ID
Swiss Prot
Synonyms	EEF1AKMT4
Calculated MW	28kDa/83kDa/86kDa/91kDa/99kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	BT-474, HepG2
Cellular location	Cytoplasmic granule membrane, Golgi apparatus membrane, Single-pass type II membrane protein
Customer validation	IF(Gallus gallus)