Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | ECE2 Rabbit pAb |
---|---|
Catalog No. | A7049 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ECE2 (NP_115707.2). |
---|---|
Sequence | MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSE |
Gene ID | |
Swiss Prot | |
Synonyms | EEF1AKMT4 |
Calculated MW | 28kDa/83kDa/86kDa/91kDa/99kDa |
Observed MW | 90kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | BT-474, HepG2 |
Cellular location | Cytoplasmic granule membrane, Golgi apparatus membrane, Single-pass type II membrane protein |
Customer validation | IF(Gallus gallus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7049? Please let us know so that we can cite the reference in this datasheet.