Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of HepG2 cells, using ECSIT antibody (A7804) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of H9C2 cells using ECSIT Rabbit pAb (A7804) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using ECSIT Rabbit pAb (A7804) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | ECSIT Rabbit pAb |
|---|---|
| Catalog No. | A7804 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-296 of human ECSIT (NP_001135936.1). |
|---|---|
| Sequence | SEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGSGRDAGGVEPLLPDAAGPGVCEEWLGQLRV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | SITPEC |
| Calculated MW | 49kDa |
| Observed MW | 49kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HepG2 |
| Cellular location | Cytoplasm, Mitochondrion, Nucleus |
| Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7804? Please let us know so that we can cite the reference in this datasheet.
