제품 > 항체 > 다중클론항체(pAb)

EDIL3 Rabbit pAb (A15772)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using EDIL3 antibody (A15772) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunofluorescence - EDIL3 Rabbit pAb (A15772)

Immunofluorescence analysis of U2OS cells using EDIL3 antibody (A15772) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	EDIL3 Rabbit pAb
Catalog No.	A15772
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human EDIL3 (NP_005702.3).
Sequence	TWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPP
Gene ID
Swiss Prot
Synonyms	DEL1
Calculated MW	54kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse lung, Mouse brain
Cellular location	Secreted