제품 > 항체 > 다중클론항체(pAb)

EFTUD2 Rabbit pAb (A7040)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using EFTUD2 Rabbit pAb (A7040) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - EFTUD2 Rabbit pAb (A7040)

Immunohistochemistry analysis of EFTUD2 in paraffin-embedded rat brain tissue using EFTUD2 Rabbit pAb (A7040) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EFTUD2 in paraffin-embedded mouse brain tissue using EFTUD2 Rabbit pAb (A7040) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - EFTUD2 Rabbit pAb (A7040)

Immunofluorescence analysis of C6 cells using EFTUD2 Rabbit pAb (A7040) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using EFTUD2 Rabbit pAb (A7040) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using EFTUD2 Rabbit pAb (A7040) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - EFTUD2 Rabbit pAb (A7040)

Immunoprecipitation analysis of 300 μg extracts of NTH-3T3 cells using 3 μg EFTUD2 Rabbit pAb (A7040). Western blot was performed from the immunoprecipitate using EFTUD2 Rabbit pAb (A7040) at a dilition of 1:2000.

Overview

Product name	EFTUD2 Rabbit pAb
Catalog No.	A7040
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a GTPase which is a component of the spliceosome complex which processes precursor mRNAs to produce mature mRNAs. Mutations in this gene are associated with mandibulofacial dysostosis with microcephaly. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human EFTUD2 (NP_004238.3).
Sequence	MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDT
Gene ID
Swiss Prot
Synonyms	MFDM; MFDGA; Snu114; Snrp116; SNRNP116; U5-116KD; EFTUD2
Calculated MW	109kDa
Observed MW	130kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, NIH/3T3, RAW264.7, C6
Cellular location	Nucleus
Customer validation	WB(Mus musculus, Homo sapiens)