제품 > 항체 > 단일클론항체(mAb)

EGR2 Rabbit mAb (A3219)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using EGR2 Rabbit mAb (A3219) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunoprecipitation - EGR2 Rabbit mAb (A3219)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg EGR2 antibody (A3219). Western blot was performed from the immunoprecipitate using EGR2 antibody (A3219) at a dilution of 1:500.

Overview

Product name	EGR2 Rabbit mAb
Catalog No.	A3219
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1932

Background

The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EGR2 (NP_000390.2).
Sequence	MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDP
Gene ID
Swiss Prot
Synonyms	AT591; CMT1D; CMT4E; KROX20; EGR2
Calculated MW	50kDa
Observed MW	53kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	SH-SY5Y, Mouse brain, Rat brain
Cellular location	Nucleus