제품 > 항체 > 다중클론항체(pAb)

EIF2B1 Rabbit pAb (A7892)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using EIF2B1 antibody (A7892) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - EIF2B1 Rabbit pAb (A7892)

Immunofluorescence analysis of U2OS cells using EIF2B1 antibody (A7892) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	EIF2B1 Rabbit pAb
Catalog No.	A7892
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-305 of human EIF2B1 (NP_001405.1).
Sequence	MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
Gene ID
Swiss Prot
Synonyms	EIF2B; EIF2BA; EIF2Balpha
Calculated MW	34kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SH-SY5Y, MCF7, SKOV3, NCI-H460, Mouse liver, Mouse brain
Cellular location	cytoplasm, cytosol, eukaryotic translation initiation factor 2B complex, plasma membrane