제품 > 항체 > 다중클론항체(pAb)

EIF3F Rabbit pAb (A7023)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using EIF3F Rabbit pAb (A7023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Human colon tissue using EIF3F Rabbit pAb (A7023) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF3F in paraffin-embedded Human pancreas tissue using EIF3F Rabbit pAb (A7023) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF3F in paraffin-embedded Rat brain tissue using EIF3F Rabbit pAb (A7023) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of EIF3F in paraffin-embedded Mouse spleen tissue using EIF3F Rabbit pAb (A7023) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - EIF3F Rabbit pAb (A7023)

Immunofluorescence analysis of NIH/3T3 cells using EIF3F Rabbit pAb (A7023) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using EIF3F Rabbit pAb (A7023) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - EIF3F Rabbit pAb (A7023)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg EIF3F antibody (A7023). Western blot was performed from the immunoprecipitate using EIF3F antibody (A7023) at a dilution of 1:1000.

Overview

Product name	EIF3F Rabbit pAb
Catalog No.	A7023
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables deubiquitinase activity and identical protein binding activity. Contributes to translation initiation factor activity. Involved in IRES-dependent viral translational initiation; protein deubiquitination; and translational initiation. Located in membrane. Part of eukaryotic translation initiation factor 3 complex. Implicated in autosomal recessive non-syndromic intellectual disability.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 88-357 of human EIF3F (NP_003745.1).
Sequence	GGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
Gene ID
Swiss Prot
Synonyms	MRT67; EIF3S5; eIF3-p47; EIF3F
Calculated MW	38kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens, Mus musculus) IP(Homo sapiens) IHC(Mus musculus)