제품 > 항체 > 단일클론항체(mAb)

ELK1 Rabbit mAb (A19046)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ELK1 Rabbit mAb (A19046) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

ABclonal:Immunoprecipitation - ELK1 Rabbit mAb (A19046)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg ELK1 antibody (A19046). Western blot was performed from the immunoprecipitate using ELK1 antibody (A19046) at a dilution of 1:1000.

Overview

Product name	ELK1 Rabbit mAb
Catalog No.	A19046
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0339

Background

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 329-428 of human ELK1 (NP_001107595.1).
Sequence	GGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
Gene ID
Swiss Prot
Synonyms	ELK1
Calculated MW	45kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, K-562, Mouse brain, Rat brain
Cellular location	Nucleus.