제품 > 항체 > 다중클론항체(pAb)

ELMOD2 Rabbit pAb (A7859)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using ELMOD2 antibody (A7859) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	ELMOD2 Rabbit pAb
Catalog No.	A7859
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of mouse ELMOD2 (Q8BGF6).
Sequence	MFVSLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYGGAQRTYRIENSLTYSKNKVLQNATRVAQSELDRCIANIMKEKNICSEKDTSFQICMRTCLLQITGYKQLYHDVENVRKKPYDSANAQHEKM
Gene ID
Swiss Prot
Synonyms	9830169G11Rik
Calculated MW	35kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, LO2
Cellular location