Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | EMP2 Rabbit pAb |
---|---|
Catalog No. | A16327 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EMP2 (NP_001415.1). |
---|---|
Sequence | VINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF |
Gene ID | |
Swiss Prot | |
Synonyms | XMP |
Calculated MW | 19kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | |
Cellular location | apical plasma membrane, cell surface, cytoplasm, cytoplasmic vesicle, cytosol, Golgi apparatus, nucleus, perinuclear region of cytoplasm, plasma membrane |
Customer validation | WB(Danio rerio) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16327? Please let us know so that we can cite the reference in this datasheet.