Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | ENOX1 Rabbit pAb |
---|---|
Catalog No. | A14282 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 450-560 of human ENOX1 (NP_060463.2). |
---|---|
Sequence | LKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ |
Gene ID | |
Swiss Prot | |
Synonyms | CNOX; PIG38; cCNOX; bA64J21.1; ENOX1 |
Calculated MW | 73kDa |
Observed MW | 73kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | DU145, A-549, Raji, HeLa, Mouse brain |
Cellular location | Cell membrane, Secreted, extracellular space |
* For research use only. Not for therapeutic or diagnostic purposes.