제품 > 항체 > 다중클론항체(pAb)

ERH Rabbit pAb (A12271)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using ERH Rabbit pAb (A12271) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	ERH Rabbit pAb
Catalog No.	A12271
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables methyl-CpG binding activity. Predicted to be involved in pyrimidine nucleoside metabolic process. Located in midbody and nucleus. Part of methylosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ERH (NP_004441.1).
Sequence	MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Gene ID
Swiss Prot
Synonyms	DROER; ERH
Calculated MW	12kDa
Observed MW	12kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, A-549
Cellular location	methylosome, nucleus