제품 > 항체 > 단일클론항체(mAb)

ERp29 Rabbit mAb (A19771)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ERp29 Rabbit mAb (A19771) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - ERp29 Rabbit mAb (A19771)

Immunohistochemistry analysis of ERp29 in paraffin-embedded mouse brain tissue using ERp29 Rabbit mAb (A19771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ERp29 in paraffin-embedded human breast cancer tissue using ERp29 Rabbit mAb (A19771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ERp29 in paraffin-embedded human colon carcinoma tissue using ERp29 Rabbit mAb (A19771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ERp29 in paraffin-embedded human liver tissue using ERp29 Rabbit mAb (A19771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ERp29 in paraffin-embedded rat kidney tissue using ERp29 Rabbit mAb (A19771) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	ERp29 Rabbit mAb
Catalog No.	A19771
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2295

Background

This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human ERp29 (P30040).
Sequence	MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNM
Gene ID
Swiss Prot
Synonyms	ERp28; ERp31; PDIA9; PDI-DB; C12orf8; HEL-S-107; ERp29
Calculated MW	29kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, HepG2, A-431, NIH/3T3, Mouse brain, Mouse kidney, Rat lung, Rat spleen, Rat kidney
Cellular location	Cell surface, Endoplasmic Reticulum, Endoplasmic Reticulum lumen, Melanosome, Smooth endoplasmic reticulum