제품 > 항체 > 다중클론항체(pAb)

ESRRB Rabbit pAb (A8416)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using ESRRB Rabbit pAb (A8416) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	ESRRB Rabbit pAb
Catalog No.	A8416
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3).
Sequence	GQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM
Gene ID
Swiss Prot
Synonyms	ERR2; ERRb; ESRL2; NR3B2; DFNB35; ERRbeta2; ERR beta-2; ESRRB
Calculated MW	48kDa
Observed MW	56kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	K-562, HT-29, 293F
Cellular location	Nucleus
Customer validation	WB(Mus musculus)