제품 > 항체 > 다중클론항체(pAb)

ETF1 Rabbit pAb (A5920)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using ETF1 antibody (A5920) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - ETF1 Rabbit pAb (A5920)

Immunofluorescence analysis of HeLa cells using ETF1 Rabbit pAb (A5920) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	ETF1 Rabbit pAb
Catalog No.	A5920
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a class-1 polypeptide chain release factor. The encoded protein plays an essential role in directing termination of mRNA translation from the termination codons UAA, UAG and UGA. This protein is a component of the SURF complex which promotes degradation of prematurely terminated mRNAs via the mechanism of nonsense-mediated mRNA decay (NMD). Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 6, 7, and X.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 278-437 of human ETF1 (NP_004721.1).
Sequence	VKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Gene ID
Swiss Prot
Synonyms	ERF; RF1; ERF1; TB3-1; D5S1995; SUP45L1
Calculated MW	49kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Raji, U-87MG, HT-1080, SKOV3, Mouse liver, Mouse heart, Mouse kidney, Rat heart
Cellular location	Cytoplasm