제품 > 항체 > 단일클론항체(mAb)

Emerin/EMD Rabbit mAb (A4187)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Emerin/EMD Rabbit mAb (A4187) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Emerin/EMD Rabbit mAb (A4187)

Immunohistochemistry analysis of paraffin-embedded Human colon using Emerin/EMD Rabbit mAb (A4187) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - Emerin/EMD Rabbit mAb (A4187)

Confocal imaging of HeLa cells using Emerin/EMD Rabbit mAb (A4187, dilution 1:100) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	Emerin/EMD Rabbit mAb
Catalog No.	A4187
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0921

Background

Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the emerin gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-254 of human Emerin/EMD (P50402).
Sequence	RERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF
Gene ID
Swiss Prot
Synonyms	STA; EDMD; LEMD5; Emerin/EMD
Calculated MW	29kDa
Observed MW	30kDa/35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse brain, Rat lung
Cellular location	Nucleoplasmic side, Nucleus inner membrane, Nucleus outer membrane, Single-pass membrane protein.