Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Eph receptor B3 (EPHB3) Rabbit mAb |
---|---|
Catalog No. | A19229 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2384 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Eph receptor B3 (EPHB3) (EPHB3) (P54753). |
---|---|
Sequence | SELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWM |
Gene ID | |
Swiss Prot | |
Synonyms | EK2; ETK2; HEK2; TYRO6 |
Calculated MW | 110kDa |
Observed MW | 110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, HT-29, SH-SY5Y, Mouse brain, Rat brain |
Cellular location | Cell membrane, Cell projection, Single-pass type I membrane protein, dendrite |
Customer validation | WB(Homo sapiens) Co-IP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19229? Please let us know so that we can cite the reference in this datasheet.