제품 > 항체 > 단일클론항체(mAb)

Epsin 1 Rabbit mAb (A20872)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Epsin 1 antibody (A20872) at1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	Epsin 1 Rabbit mAb
Catalog No.	A20872
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2813

Background

This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Epsin 1 (NP_001123544.1).
Sequence	EPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKA
Gene ID
Swiss Prot
Synonyms	EPN1
Calculated MW	60kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, U-937, HeLa, Mouse liver, Rat liver
Cellular location	Clathrin-coated pit, Cytosol, Endosome, nucleus, Plasma membrane