제품 > 항체 > 단일클론항체(mAb)

Exportin 2 (XPO2) Rabbit mAb (A1041)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using Exportin 2 (XPO2) Rabbit mAb (A1041) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	Exportin 2 (XPO2) Rabbit mAb
Catalog No.	A1041
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1856

Background

CSE1L (Chromosome Segregation 1-Like) is located on 20q13.13, and encodes a 971-amino-acid protein. It associates with microtubules and mitotic spindles, and is also considered to have a role in tumor progression. The CSE1L protein includes a nuclear localization signal allowing for transport into the nucleus via the importin-alpha/beta heterodimer. In addition, CSE1L plays roles in cell proliferation and apoptosis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 872-971 of human Exportin 2 (XPO2) (P55060).
Sequence	LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
Gene ID
Swiss Prot
Synonyms	CAS; CSE1; XPO2
Calculated MW	110kDa
Observed MW	105kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, 293T, Jurkat, Mouse testis, Mouse thymus
Cellular location	Cytoplasm, Nucleus