Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Ezrin/Radixin/Moesin Rabbit pAb |
---|---|
Catalog No. | A21093 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 487-586 of human Ezrin/Radixin/Moesin (NP_003370.2). |
---|---|
Sequence | ESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL |
Gene ID | |
Swiss Prot | |
Synonyms | CVL; CVIL; VIL2; HEL-S-105; DFNB24; HEL70; IMD50 |
Calculated MW | 69kDa/68kDa/67kDa |
Observed MW | 76kDa/80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, 293T, Mouse brain, PC-12 |
Cellular location | actin cytoskeleton, apical plasma membrane, basolateral plasma membrane, cell projection, ciliary basal body, cortical cytoskeleton, cytoplasm, cytoplasmic side of apical plasma membrane, cytosol, endosome, extracellular exosome, extracellular space, fibrillar center, filopodium, focal adhesion, immunological synapse, microvillus membrane, perinuclear region of cytoplasm, plasma membrane, plasma membrane raft, ruffle membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.