Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | FA2H Rabbit pAb |
---|---|
Catalog No. | A13874 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 95-170 of human FA2H (NP_077282.3). |
---|---|
Sequence | NEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWY |
Gene ID | |
Swiss Prot | |
Synonyms | FAAH; FAH1; SCS7; SPG35; FAXDC1; FA2H |
Calculated MW | 43kDa |
Observed MW | 40kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Mouse stomach, Mouse kidney, Rat brain |
Cellular location | Endoplasmic reticulum membrane, Microsome membrane, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.