제품 > 항체 > 다중클론항체(pAb)

FAM117B Rabbit pAb (A3551)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using FAM117B Rabbit pAb (A3551).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Overview

Product name	FAM117B Rabbit pAb
Catalog No.	A3551
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

FAM117B (Family With Sequence Similarity 117 Member B) is a Protein Coding gene. Diseases associated with FAM117B include Lateral Sclerosis and Amyotrophic Lateral Sclerosis 2, Juvenile. An important paralog of this gene is GLCCI1.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 293-372 of human FAM117B (NP_775782.2).
Sequence	SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI
Gene ID
Swiss Prot
Synonyms	ALS2CR13; FAM117B
Calculated MW	62kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293, Hela
Cellular location
Customer validation	WB(Mus musculus)