Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using FAM50A Rabbit mAb (A21133) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of various lysates using FAM50A Rabbit mAb (A21133) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using FAM50A Rabbit mAb (A21133) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse liver using FAM50A Rabbit mAb (A21133) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using FAM50A Rabbit mAb (A21133) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Product name | FAM50A Rabbit mAb |
|---|---|
| Catalog No. | A21133 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC3010 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FAM50A (NP_004690.1). |
|---|---|
| Sequence | MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | XAP5; HXC26; MRXSA; HXC-26; DXS9928E; FAM50A |
| Calculated MW | 40kDa |
| Observed MW | 40kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | U-251MG, PC-12, NIH/3T3, Mouse placenta |
| Cellular location | Nucleoplasm, nucleus |
| Customer validation | WB(Mus musculus) IHC(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21133? Please let us know so that we can cite the reference in this datasheet.
