Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | FAM62B Rabbit pAb |
---|---|
Catalog No. | A12833 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 630-760 of human FAM62B (NP_065779.1). |
---|---|
Sequence | EKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRLRQLENGTTLGQSPLG |
Gene ID | |
Swiss Prot | |
Synonyms | E-Syt2; FAM62B; CHR2SYT |
Calculated MW | 102kDa |
Observed MW | 102kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG, HT-29, Mouse liver, Mouse kidney |
Cellular location | Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Peripheral membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.