제품 > 항체 > 단일클론항체(mAb)

FDX1/ADX Rabbit mAb (A20895)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FDX1/ADX Rabbit mAb (A20895) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - FDX1/ADX Rabbit mAb (A20895)

Immunofluorescence analysis of A-549 cells using FDX1/ADX Rabbit mAb (A20895) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using FDX1/ADX Rabbit mAb (A20895) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using FDX1/ADX Rabbit mAb (A20895) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	FDX1/ADX Rabbit mAb
Catalog No.	A20895
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2854

Background

This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FDX1/ADX (P10109).
Sequence	MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDI
Gene ID
Swiss Prot
Synonyms	ADX; FDX; LOH11CR1D; FDX1/ADX
Calculated MW	19kDa
Observed MW	13kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, A-549, U-87MG, Mouse liver, Mouse testis, Mouse kidney, Rat testis, Rat kidney
Cellular location	Mitochondrion matrix.
Customer validation	WB(Homo sapiens, Gallus gallus) IHC(Mus musculus) WB(Mus musculus)