Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FDX1/ADX Rabbit mAb |
---|---|
Catalog No. | A20895 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2854 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FDX1/ADX (P10109). |
---|---|
Sequence | MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDI |
Gene ID | |
Swiss Prot | |
Synonyms | ADX; FDX; LOH11CR1D; FDX1/ADX |
Calculated MW | 19kDa |
Observed MW | 13kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HepG2, A-549, U-87MG, Mouse liver, Mouse testis, Mouse kidney, Rat testis, Rat kidney |
Cellular location | Mitochondrion matrix. |
Customer validation | WB(Homo sapiens, Gallus gallus, Rattus norvegicus) IHC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20895? Please let us know so that we can cite the reference in this datasheet.