제품 > 항체 > 다중클론항체(pAb)

FERMT2 Rabbit pAb (A8709)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FERMT2 Rabbit pAb (A8709) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - FERMT2 Rabbit pAb (A8709)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using FERMT2 Rabbit pAb (A8709) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using FERMT2 Rabbit pAb (A8709) at dilution of 1:300 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	FERMT2 Rabbit pAb
Catalog No.	A8709
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including actin binding activity; phosphatidylinositol-3, 4, 5-trisphosphate binding activity; and type I transforming growth factor beta receptor binding activity. Involved in several processes, including cell surface receptor signaling pathway; positive regulation of cell differentiation; and positive regulation of cellular component biogenesis. Acts upstream of or within cell adhesion and protein localization to cell junction. Located in cytosol; focal adhesion; and nucleoplasm. Is extrinsic component of cytoplasmic side of plasma membrane. Part of adherens junction and plasma membrane. Biomarker of acute myeloid leukemia.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 380-550 of human FERMT2 (NP_006823.1).
Sequence	KVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMS
Gene ID
Swiss Prot
Synonyms	MIG2; KIND2; mig-2; UNC112; PLEKHC1; UNC112B; FERMT2
Calculated MW	78kDa
Observed MW	78kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A-549, HT-29, LO2, MCF7, HT-1080, Mouse liver
Cellular location	Cell junction, Cell projection, Cell surface, Cytoplasm, Cytoplasmic side, I band, Membrane, Nucleus, Peripheral membrane protein, cell cortex, cytoskeleton, focal adhesion, lamellipodium membrane, myofibril, sarcomere