제품 > 항체 > 단일클론항체(mAb)

FHL5 Rabbit mAb (A25133)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with FHL5 using FHL5 Rabbit mAb(A25133) at 1:4000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - FHL5 Rabbit mAb (A25133)

Confocal imaging of 293T cells transfected with FHL5 using FHL5 Rabbit mAb (A25133, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - FHL5 Rabbit mAb (A25133)

Immunoprecipitation of FHL5 in 300 µg extracts from 293T cells transfected with FHL5, using 3 µg FHL5 Rabbit mAb (A25133). Western blot analysis was performed using FHL5 Rabbit mAb (A25133) at 1:3000 dilution.

Overview

Product name	FHL5 Rabbit mAb
Catalog No.	A25133
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63031

Background

The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 162-284 of human FHL5 (NP_065228.4)
Sequence	YCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
Gene ID
Swiss Prot
Synonyms	ACT; FHL-5; dJ393D12.2; 1700027G07Rik; FHL5
Calculated MW	33kDa
Observed MW	35kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T transfected with FHL5
Cellular location	Nucleus