제품 > 항체 > 다중클론항체(pAb)

FIBP Rabbit pAb (A6436)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FIBP Rabbit pAb (A6436) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - FIBP Rabbit pAb (A6436)

Immunohistochemistry analysis of paraffin-embedded Mouse heart using FIBP Rabbit pAb (A6436) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunoprecipitation - FIBP Rabbit pAb (A6436)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg FIBP antibody (A6436). Western blot was performed from the immunoprecipitate using FIBP antibody (A6436) at a dilution of 1:1000.

Overview

Product name	FIBP Rabbit pAb
Catalog No.	A6436
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenic action of aFGF. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-364 of human FIBP (NP_004205.2).
Sequence	MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Gene ID
Swiss Prot
Synonyms	FGFIBP; FIBP-1; TROFAS; FIBP
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, SW620, MCF7, Rat brain
Cellular location	Endomembrane system, Nucleus, Peripheral membrane protein.
Customer validation	WB(Homo sapiens)