Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | FLG Rabbit mAb |
---|---|
Catalog No. | A23193 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC60254 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-92AA of human FLG (NP_002007.1). |
---|---|
Sequence | MSTLLENIFAIINLFKQYSKKDKNTDTLSKKELKELLEKEFRQILKNPDDPDMVDVFMDHLDIDHNKKIDFTEFLLMVFKLAQAYYESTRKE |
Gene ID | |
Swiss Prot | |
Synonyms | FLG1; ATOD2; FLG-1 |
Calculated MW | 435kDa |
Observed MW | 50kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse stomach, Rat stomach |
Cellular location | Cytoplasmic ribonucleoprotein granule, Cytosol, keratohyalin granule, Nucleus |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23193? Please let us know so that we can cite the reference in this datasheet.