제품 > 항체 > 단일클론항체(mAb)

FOXP3 Rabbit mAb (A4953)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Jurkat cells, using FOXP3 Rabbit mAb (A4953) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - FOXP3 Rabbit mAb (A4953)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg FOXP3 antibody (A4953). Western blot was performed from the immunoprecipitate using FOXP3 antibody (A4953) at a dilution of 1:1000.

Overview

Product name	FOXP3 Rabbit mAb
Catalog No.	A4953
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1159

Background

The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 286-431 of human FOXP3 (Q9BZS1).
Sequence	GSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP
Gene ID
Swiss Prot
Synonyms	JM2; AIID; IPEX; PIDX; XPID; DIETER; FOXP3
Calculated MW	47kDa
Observed MW	45kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Jurkat
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Homo sapiens, Rattus norvegicus) IF(Homo sapiens, Mus musculus) FC(Mus musculus) IHC(Rattus norvegicus)