Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | FTO Rabbit mAb |
---|---|
Catalog No. | A3861 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0851 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FTO (Q9C0B1). |
---|---|
Sequence | MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIG |
Gene ID | |
Swiss Prot | |
Synonyms | GDFD; ALKBH9; BMIQ14; FTO |
Calculated MW | 58kDa |
Observed MW | 60kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, 293T, SH-SY5Y |
Cellular location | Nucleus, Nucleus speckle. |
Customer validation | WB(Homo sapiens, Mus musculus) IHC(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens) IP(Homo sapiens) ELISA(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3861? Please let us know so that we can cite the reference in this datasheet.