제품 > 항체 > 단일클론항체(mAb)

FUNDC1 Rabbit mAb (A22656)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Immunohistochemistry analysis of paraffin-embedded Rat kidney using FUNDC1 Rabbit mAb (A22656) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	FUNDC1 Rabbit mAb
Catalog No.	A22656
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57663

Background

This gene encodes a protein with a FUN14 superfamily domain. The function of the encoded protein is not known.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FUNDC1. (NP_776155.1).
Sequence	VATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFL
Gene ID
Swiss Prot
Synonyms	FUNDC1
Calculated MW	17kDa
Observed MW	Refer to figures

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, , 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	mitochondrial outer membrane.
Customer validation	WB(Canis lupus familiaris) IF(Homo sapiens)