제품 > 항체 > 다중클론항체(pAb)

FUS Rabbit pAb (A21830)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FUS Rabbit pAb (A21830) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - FUS Rabbit pAb (A21830)

Immunohistochemistry analysis of paraffin-embedded mouse brain using FUS Rabbit pAb (A21830) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat spleen using FUS Rabbit pAb (A21830) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - FUS Rabbit pAb (A21830)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg FUS antibody (A21830). Western blot was performed from the immunoprecipitate using FUS (A21830) at a dilution of 1:1000.

Overview

Product name	FUS Rabbit pAb
Catalog No.	A21830
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1).
Sequence	TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Gene ID
Swiss Prot
Synonyms	TLS; ALS6; ETM4; FUS1; POMP75; altFUS; HNRNPP2; FUS
Calculated MW	53kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	U-937, Jurkat
Cellular location	Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

FUS Rabbit pAb images

Western blot - FUS Rabbit pAb (A21830)

Immunohistochemistry - FUS Rabbit pAb (A21830)

Immunoprecipitation - FUS Rabbit pAb (A21830)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg FUS antibody (A21830). Western blot was performed from the immunoprecipitate using FUS (A21830) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.