Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Fam221a Rabbit pAb (A20273) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of A-549 cells using Fam221a Rabbit pAb (A20273) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Fam221a Rabbit pAb |
|---|---|
| Catalog No. | A20273 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-292 of mouse Fam221a (NP_766315.1). |
|---|---|
| Sequence | MERLTLPPGGAEAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRCKHFADQHSAALGFTCNACSKCSGFHSCYTCACGQPAYAHDTVVETRQERLAQGKPVGRDVPYAAMGGLTGFSSLAEGYMRLDDSGIGAPSVEVLDSAVSAMDHPFLRAMHAPSTSSPQPLAGGNEVGPSTQLSSLRKPEEDDMAYFERQYQERIKLEKAAKQKGKV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | D330028D13Rik; Fam221a |
| Calculated MW | 33kDa |
| Observed MW | 33kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Mouse testis, Rat testis |
| Cellular location | Cytoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
