제품 > 항체 > 단일클론항체(mAb)

Fetuin A/AHSG Rabbit mAb (A19264)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of Human plasma, using Fetuin A/AHSG antibody (A19264) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	Fetuin A/AHSG Rabbit mAb
Catalog No.	A19264
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2433

Background

The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fetuin A/AHSG (P02765).
Sequence	MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARC
Gene ID
Swiss Prot
Synonyms	AHS; A2HS; HSGA; APMR1; FETUA
Calculated MW	39kDa
Observed MW	50kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Human plasma
Cellular location	Secreted