Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using GABARAPL1 Rabbit mAb (A23781) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using GABARAPL1 Rabbit mAb (A23781) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | GABARAPL1 Rabbit mAb |
|---|---|
| Catalog No. | A23781 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC61739 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAPL1. (NP_113600.1). |
|---|---|
| Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | GABARAPL1; APG8-LIKE; APG8L; ATG8; ATG8B; ATG8L; GEC1; GABA type A receptor associated protein like 1 |
| Calculated MW | 14kDa/17kDa |
| Observed MW | 16-18kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | Hela, MCF-7(Low expression control), Mouse brain, Mouse liver, Rat brain |
| Cellular location | Cytoplasm, Cytoplasmic vesicle, Cytoplasmic vesicle membrane, Endoplasmic reticulum, Golgi apparatus, Lipid-anchor, autophagosome, cytoskeleton |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
