제품 > 항체 > 다중클론항체(pAb)

GATAD2B Rabbit pAb (A9716)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GATAD2B Rabbit pAb (A9716) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - GATAD2B Rabbit pAb (A9716)

Immunohistochemistry analysis of paraffin-embedded Mouse pancreas using GATAD2B Rabbit pAb (A9716) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - GATAD2B Rabbit pAb (A9716)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg GATAD2B antibody (A9716). Western blot was performed from the immunoprecipitate using GATAD2B antibody (A9716) at a dilution of 1:1000.

Overview

Product name	GATAD2B Rabbit pAb
Catalog No.	A9716
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intellectual disability and dysmorphic features associated with cognitive disability.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human GATAD2B (NP_065750.1).
Sequence	MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT
Gene ID
Swiss Prot
Synonyms	p68; GANDS; MRD18; P66beta; GATAD2B
Calculated MW	65kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	U-251MG, LO2, HeLa, Jurkat, Mouse brain, Mouse kidney, Rat thymus
Cellular location	Nucleus speckle