제품 > 항체 > 단일클론항체(mAb)

GBP1 Rabbit mAb (A0570)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using GBP1 Rabbit mAb (A0570) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - GBP1 Rabbit mAb (A0570)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using GBP1 Rabbit mAb (A0570) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	GBP1 Rabbit mAb
Catalog No.	A0570
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2521

Background

Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence of 2 binding motifs rather than 3.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 493-592 of human GBP1 (P32455).
Sequence	RVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS
Gene ID
Swiss Prot
Synonyms	GBP1; guanylate-binding protein 1
Calculated MW	68kDa
Observed MW	50-55\68kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Jurkat, Rat heart
Cellular location	Cell membrane, Cytoplasm, Cytoplasmic side, Golgi apparatus membrane, Lipid-anchor, Secreted
Customer validation	Other(Homo sapiens)