제품 > 항체 > 다중클론항체(pAb)

GHRHR Rabbit pAb (A8421)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using GHRHR Rabbit pAb (A8421) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - GHRHR Rabbit pAb (A8421)

Immunofluorescence analysis of rat pituitary gland cells using GHRHR Rabbit pAb (A8421) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	GHRHR Rabbit pAb
Catalog No.	A8421
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GHRHR (NP_000814.2).
Sequence	MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVK
Gene ID
Swiss Prot
Synonyms	GRFR; GHRFR; IGHD4; IGHD1B
Calculated MW	47kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain, Rat brain
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	IF(Homo sapiens) WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구신호 변환G 단백질 신호전달G-단백질 결합 수용체(GPCR)

GHRHR Rabbit pAb images

Western blot - GHRHR Rabbit pAb (A8421)

Immunofluorescence - GHRHR Rabbit pAb (A8421)

Immunofluorescence analysis of rat pituitary gland cells using GHRHR Rabbit pAb (A8421) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.